PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100010740171
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 451aa    MW: 49774.1 Da    PI: 5.3412
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100010740171genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-33251305155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmk +gLt++hvkSHLQkYR+
  Ote100010740171|100010740171 251 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMKAEGLTIYHVKSHLQKYRT 305
                                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.313248308IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-30249307IPR009057Homeodomain-like
SuperFamilySSF466892.87E-17249305IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-24251305IPR006447Myb domain, plants
PfamPF002492.7E-10253304IPR001005SANT/Myb domain
PfamPF143794.2E-24336382IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MGTEPALSIQ RPGASQLSNS GASGALSSLS ALSTPRQGNR PNFSDSHQVS LGRVFNQRLP  60
ATLPSNSGVV GHIYSSSSGF SSDLHFSSVQ QQEKHPKQSP FISQSTNSKS FDLVQHSTDS  120
GYLQSTASSH SNKDNMNSWC TDALPEFFDF QNSQLDVGNS VAVVAPSEDL CKPSEWQDWA  180
DNLITEDDAL TSDWNDILTD ANTLDPDLKL MSKPSTCISM QPQVAQQLPA TYRETISAFG  240
QSSSTNTAPA KQRMRWTPEL HEAFVEAVNK LGGSERATPK GVLKLMKAEG LTIYHVKSHL  300
QKYRTARYKP ESTEESSERK TTSIDQLSSL DLKTGIEITE ALRLQMEVQK RLHEQLEIQR  360
NLQLRIEEQG RCLQMMFEKQ YKAGPEWLKG GSSTAENALK ELTDIDQKPP PKDNSVAEAD  420
KSNTEGDSAE VLENSSAKVE EQPLKRARVH D
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083055.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011083056.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011083057.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A022S2540.0A0A022S254_ERYGU; Uncharacterized protein
STRINGVIT_07s0005g04120.t011e-152(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349